Product & Technology leadership, GenAI development, longevity optimization, and aviation - from Daniel Keller.https://danielkeller.com/en-ushttps://danielkeller.com/tech/fde-enterprise-table-stakes-2026/https://danielkeller.com/tech/fde-enterprise-table-stakes-2026/What was a Palantir niche in 2024 is now the dominant enterprise AI go-to-market. The AI Engineer World's Fair proved FDEs are a structural shift, not a trend.Mon, 06 Jul 2026 00:00:00 GMTTechforward-deployed-engineeringenterprise-aigo-to-marketagent-engineeringai-deploymenthttps://danielkeller.com/tech/cognitive-debt-understanding-still-matters/https://danielkeller.com/tech/cognitive-debt-understanding-still-matters/As AI agents write more code than ever, the real risk isn't quality - it's losing the deep understanding that lets you make creative architectural decisions. Countermeasures from AI Engineer World's Fair 2026.Sun, 05 Jul 2026 00:00:00 GMTTechai-agentssoftware-engineeringcognitive-debtdeveloper-experienceai-engineer-worlds-fairhttps://danielkeller.com/leadership/ai-pods-replacing-scrum-teams/https://danielkeller.com/leadership/ai-pods-replacing-scrum-teams/Why the org redesign is the multiplier that separates 1.2x from 3x+ productivity. A practical guide from AI Engineer World's Fair 2026.Sun, 05 Jul 2026 00:00:00 GMTLeadershipaiteamsorg-designagentsproductivityengineering-leadershipscrumagilehttps://danielkeller.com/tech/agentic-stack-skills-harness/https://danielkeller.com/tech/agentic-stack-skills-harness/After AI Engineer World's Fair 2026, the message is clear - stop chasing models and invest in the harness. The agentic stack is converging around skills governance and knowledge engineering, not which foundation model you run.Sat, 04 Jul 2026 00:00:00 GMTTechagentic-aimcpskillsai-engineeringdeveloper-toolsarchitecturehttps://danielkeller.com/tech/verification-not-generation/https://danielkeller.com/tech/verification-not-generation/Generation is solved. The real engineering challenge is now verification - building layered quality gates that let AI-generated code ship to production with confidence.Fri, 03 Jul 2026 00:00:00 GMTTechgenaievalsverificationcode-qualityagentsengineeringhttps://danielkeller.com/tech/software-factories-are-real/https://danielkeller.com/tech/software-factories-are-real/At AI Engineer World's Fair 2026, the defining idea was clear - software engineering is becoming factory engineering. Here's what that means for teams shipping real products today.Thu, 02 Jul 2026 00:00:00 GMTTechai-engineeringagentssoftware-developmentconferencesproductivityhttps://danielkeller.com/tech/harness-ten-components-not-seven/https://danielkeller.com/tech/harness-ten-components-not-seven/Tomasz Tunguz's seven-component AI agent harness is the cleanest architectural breakdown I have seen. It is also half the picture. The technical harness without the leadership, customer-engagement, and business-model layers is a static product. Here is what I would add.Thu, 28 May 2026 00:00:00 GMTTechtunguzai-harnessagentic-architectureempowered-teamsforward-deployed-engineersbusiness-modelleadershipagentic-flywheelhttps://danielkeller.com/tech/forward-deployed-ai-engineers/https://danielkeller.com/tech/forward-deployed-ai-engineers/Palantir's claim that SaaS is dead is provocatively wrong. The useful read is that AI is blurring the line between custom and packaged software, and the SaaS companies that win the next decade will pair a strong platform core with Forward Deployed AI Engineers - and feed every customer engagement back into the platform.Sun, 17 May 2026 00:00:00 GMTTechpalantirsaasforward-deployed-engineersai-engineeringplatform-strategyagentic-flywheelontologyenterprise-softwarebusiness-modelhttps://danielkeller.com/tech/gitlab-act-2-agentic-restructure/https://danielkeller.com/tech/gitlab-act-2-agentic-restructure/Bill Staples just published the most consequential CEO letter of 2026. GitLab is flattening three layers of management, nearly doubling its number of empowered teams, rebuilding Git itself for machine scale, and retiring its values framework. It is the agentic-era empowerment thesis stress-tested on a public company.Wed, 13 May 2026 00:00:00 GMTTechgitlabagentic-eraempowered-teamsbill-staplesrestructureleadershipagentic-developmentmachine-scaleceo-letterhttps://danielkeller.com/tech/leading-ai-empowerment/https://danielkeller.com/tech/leading-ai-empowerment/Kief Morris's agentic flywheel, published on Martin Fowler's site, lands almost word for word on the same principles Marty Cagan and Reed Hastings have been preaching for decades. Leading AI agents isn't a new discipline. It's empowered product management with a new kind of teammate.Wed, 22 Apr 2026 00:00:00 GMTTechagentic-flywheelmartin-fowlerkief-morrisempowered-teamsmarty-caganreed-hastingsleadershipagentic-developmentcontext-not-controlhttps://danielkeller.com/tech/vibe-coding-management-problem/https://danielkeller.com/tech/vibe-coding-management-problem/Eric Schluntz (Anthropic) argues the real challenge of AI-assisted engineering is the oldest one in management - how do you verify work you can't read yourself? My take on leaf nodes, the 22,000-line PR, and why being Claude's PM is the new engineering craft.Wed, 22 Apr 2026 00:00:00 GMTTechvibe-codingclaude-codeagentic-developmenteric-schluntzleaf-nodesexponentialsengineering-managementhttps://danielkeller.com/tech/plaid-idea-to-launch-skill/https://danielkeller.com/tech/plaid-idea-to-launch-skill/A hands-on test of PLAID, a Claude Code skill that takes a founder from raw idea to PRD, roadmap, and go-to-market plan. What worked, what didn't, and where it fits next to Osmani's agent-skills and Spec Kit.Thu, 16 Apr 2026 00:00:00 GMTTechagent-skillsclaude-codeplaidproduct-developmentspec-driven-developmentvibe-engineeringsolo-founderhttps://danielkeller.com/leadership/book-no-rules-rules/https://danielkeller.com/leadership/book-no-rules-rules/Reed Hastings' No Rules Rules isn't just about Netflix - it's the operating manual for high-trust, high-autonomy teams that ship fast. Here's why it matters more now than when it was written.Tue, 14 Apr 2026 00:00:00 GMTLeadershipbooksleadershipcultureautonomynetflixtalent-densitycandorai-teamshttps://danielkeller.com/tech/the-last-bottleneck/https://danielkeller.com/tech/the-last-bottleneck/One person can now build what used to take a team of fifty. Here's the tectonic shift - and what I'm already seeing in my own work with AI agents, orchestration frameworks, and persistent memory layers.Sat, 11 Apr 2026 00:00:00 GMTTechai-agentsone-person-teammythospaperclip-aigbrainagentic-developmentfuture-of-workhttps://danielkeller.com/tech/favourite-claude-mcps-macos/https://danielkeller.com/tech/favourite-claude-mcps-macos/The most important MCP servers and Claude Code skills I use to boost agentic AI productivity - what they do, why they matter, and copy-paste install instructions for each one.Fri, 10 Apr 2026 00:00:00 GMTTechclaudemcpmacosclaude-codeclaude-desktopxmindobsidianproductivityskillsfirecrawlplaywrightmarpnotebooklmgoogle-workspaceagentic-aiagent-skillsmarkitdownhttps://danielkeller.com/tech/skills-framework-vibe-engineering/https://danielkeller.com/tech/skills-framework-vibe-engineering/Why Anthropic's Agent Skills and Addy Osmani's skills framework are the missing discipline layer for serious AI-assisted software engineering - and how they compare to GitHub's Spec Kit.Fri, 10 Apr 2026 00:00:00 GMTTechagent-skillsclaude-codevibe-engineeringagentic-developmentspec-kitprogressive-disclosureengineering-standardshttps://danielkeller.com/tech/gemma4-in-claude-code/https://danielkeller.com/tech/gemma4-in-claude-code/A step-by-step guide to running Gemma 4 locally via LM Studio and calling it from inside a Claude Code session - for offline reasoning, batch processing, privacy-sensitive data, and zero-cost first-pass drafts that hand off to Claude when you need the heavy hitter.Wed, 08 Apr 2026 00:00:00 GMTTechclaude-codegemma4lm-studioollamalocal-llmhybrid-aiopenai-compatibleapple-silicontutorialhttps://danielkeller.com/tech/claude-code-ultraplan/https://danielkeller.com/tech/claude-code-ultraplan/Anthropic just shipped a hidden Claude Code feature called Ultraplan. Instead of planning locally, your session is offloaded to a multi-agent Opus 4.6 swarm in the cloud that builds a richer, faster, more structured plan - and then teleports it back to your terminal for execution.Tue, 07 Apr 2026 00:00:00 GMTTechclaude-codeultraplanplanningopus-4-6multi-agentcloudagentichttps://danielkeller.com/flying/lpv-vs-lnav-vnav/https://danielkeller.com/flying/lpv-vs-lnav-vnav/A complete breakdown of the differences between LPV and LNAV/VNAV approaches, including WAAS, SBAS requirements, decision altitudes, and when to use each type.Mon, 06 Apr 2026 00:00:00 GMTFlyingifrrnavgpslpvlnavvnavwaassbasapproachesinstrument-flyinghttps://danielkeller.com/tech/gstack-framework-claude-code/https://danielkeller.com/tech/gstack-framework-claude-code/How the Y Combinator CEO's open-source toolkit structures AI coding around 23 specialist roles - from product review to security auditing - and why the role decomposition pattern matters more than the tool itself.Sun, 05 Apr 2026 00:00:00 GMTTechclaude-codegstackgarry-tanskillsagentic-aiworkflowproductivityy-combinatorcode-reviewqahttps://danielkeller.com/flying/garmin-perspective-update/https://danielkeller.com/flying/garmin-perspective-update/Step-by-step guide to updating navdata, obstacles, terrain, and charts on the Cirrus Perspective system using three SD cards -- including the correct circuit breaker sequence.Sat, 04 Apr 2026 00:00:00 GMTFlyinggarming1000perspectivecirrusnavdatajeppesensd-cardavionicshttps://danielkeller.com/leadership/bold-targets-fight-incrementalism/https://danielkeller.com/leadership/bold-targets-fight-incrementalism/How safe, incremental goals erode competitive advantage and why OKRs done right force the creative leaps that move businesses forward.Sat, 04 Apr 2026 00:00:00 GMTLeadershipokrsstrategyinnovationleadershipgoal-settingexecutionhttps://danielkeller.com/leadership/fleet-of-fast-boats/https://danielkeller.com/leadership/fleet-of-fast-boats/Why small autonomous teams outperform large organizations -- lessons from Microsoft, four exits, and 25 years of building tech companies.Sat, 04 Apr 2026 00:00:00 GMTLeadershiporg-designteamsautonomyspeedinnovationleadershipmicrosofthttps://danielkeller.com/leadership/pilot-and-business/https://danielkeller.com/leadership/pilot-and-business/Cockpit principles that transfer directly to business -- from data-driven weather decisions and continuous course corrections to crystal-clear targets and the discipline of checklists.Sat, 04 Apr 2026 00:00:00 GMTLeadershipflyingleadershipdecision-makingchecklistsdata-drivencirrusaviationhttps://danielkeller.com/leadership/model-your-company/https://danielkeller.com/leadership/model-your-company/Why CTOs must model the full mechanics of their company and trace every engineering decision back to business outcomes and growth targets.Sat, 04 Apr 2026 00:00:00 GMTLeadershipbusiness-modelingstrategymetricsgrowthctoleadershiphttps://danielkeller.com/leadership/set-expectations-right/https://danielkeller.com/leadership/set-expectations-right/Why managing expectations with shareholders and stakeholders is a leadership superpower -- and what happens when you get it wrong.Sat, 04 Apr 2026 00:00:00 GMTLeadershipstakeholder-managementleadershipcommunicationtrustexecutionhttps://danielkeller.com/tech/headless-agents/https://danielkeller.com/tech/headless-agents/The step-by-step guide to transitioning from local Claude Code sessions to persistent, headless backend agents you control from your phone. Dispatch, remote control, agent teams, and event-driven automation.Fri, 03 Apr 2026 00:00:00 GMTTechclaude-codeheadlessdispatchremote-controlagent-teamsautomationdevopshttps://danielkeller.com/tech/gemma4-local-coding/https://danielkeller.com/tech/gemma4-local-coding/Google's Gemma 4 26B runs locally on Apple Silicon, scoring within single digits of GPT-5.2 and Claude Opus 4.5 on reasoning benchmarks - reshaping the local-plus-cloud AI coding workflow.Thu, 02 Apr 2026 00:00:00 GMTTechgemma4local-llmapple-siliconollamacoding-assistantopen-weightsapache-2hybrid-aibenchmarkshttps://danielkeller.com/tech/perfect-claude-md/https://danielkeller.com/tech/perfect-claude-md/How I use CLAUDE.md files to encode engineering excellence standards - turning tribal knowledge into enforceable, AI-augmented guardrails for building enterprise-grade SaaS.Wed, 25 Mar 2026 00:00:00 GMTTechclaude-mdclaude-codeengineering-standardsenterprisesaasagentic-developmentclean-codetestingci-cdhttps://danielkeller.com/tech/local-llm-setup/https://danielkeller.com/tech/local-llm-setup/A practical guide to running powerful language models locally on Apple Silicon - model selection, MLX vs Ollama, quantization trade-offs, and when local beats cloud.Sun, 15 Mar 2026 00:00:00 GMTTechlocal-llmqwen3deepseekmlxollamaapple-siliconprivacydeveloper-toolshttps://danielkeller.com/tech/agentic-development-patterns/https://danielkeller.com/tech/agentic-development-patterns/Practical patterns and workflows for agentic software development using Claude Code, Cursor, and local LLMs - from parallel workstreams to overnight agent factories.Sun, 01 Mar 2026 00:00:00 GMTTechagentic-developmentclaude-codecursorllmdeveloper-toolsworkflowhttps://danielkeller.com/tech/nutrispan-app/https://danielkeller.com/tech/nutrispan-app/A React Native app that turns longevity optimization into a game - with a Longevity Impact Score, 2,000+ food database, daily checklists, streaks, and achievements grounded in peer-reviewed science.Sun, 01 Mar 2026 00:00:00 GMTTechreact-nativeexpohealthlongevitygamificationzustandtypescripthttps://danielkeller.com/tech/sortflex/https://danielkeller.com/tech/sortflex/A browser-based 3D design tool for custom holders, organizers, and mounts. Drag and drop everyday items onto a base plate, then 3D print at home or order a printed version shipped to your door.Sun, 01 Mar 2026 00:00:00 GMTTechreact-three-fibercadquery3d-printingcloudflarevitereacthttps://danielkeller.com/tech/ai-driven-development/https://danielkeller.com/tech/ai-driven-development/How agentic AI has transformed software development - from pair programming to autonomous coding agents, overnight agent factories, and vibe coding.Sun, 15 Feb 2026 00:00:00 GMTTechaisoftware-developmentclaude-codecursoragentic-developmentvibe-codinghttps://danielkeller.com/tech/ai-resources/https://danielkeller.com/tech/ai-resources/A curated collection of the most important AI tools, frameworks, and resources for product and tech leaders - updated for the agentic era.Sun, 01 Feb 2026 00:00:00 GMTTechairesourcestoolsclaude-codecursoragentic-developmentlocal-llmhttps://danielkeller.com/tech/three-tier-ai-architecture/https://danielkeller.com/tech/three-tier-ai-architecture/A practical framework for deciding when to use hard-coded rules, trained ML models, or LLM agents in production AI systems - with real examples from enterprise SaaS.Sun, 01 Feb 2026 00:00:00 GMTTechai-architecturellmmachine-learningproductionsystem-designhttps://danielkeller.com/tech/ai-prompting/https://danielkeller.com/tech/ai-prompting/How prompting has evolved from clever tricks to system-level specification - CLAUDE.md files, structured outputs, tool-use patterns, and when prompting still matters.Tue, 20 Jan 2026 00:00:00 GMTTechaipromptingllmclaude-mdstructured-outputtool-useagentic-aihttps://danielkeller.com/tech/ai-in-a-nutshell/https://danielkeller.com/tech/ai-in-a-nutshell/A concise overview of AI models, fundamental concepts, and the current state of AI engineering - from frontier models to local LLMs and agentic systems.Thu, 15 Jan 2026 00:00:00 GMTTechaimachine-learningllmfoundation-modelsai-engineeringagentic-aimcphttps://danielkeller.com/tech/overnight-agent-factory/https://danielkeller.com/tech/overnight-agent-factory/How I run parallel AI agents overnight to build production software while I sleep.Thu, 15 Jan 2026 00:00:00 GMTTechclaude-codecursoragentic-developmentminimaxhttps://danielkeller.com/tech/applied-ai-mlops/https://danielkeller.com/tech/applied-ai-mlops/How to bridge the gap between AI research and production - from classical MLOps to MCP servers, tool-use APIs, RAG pipelines, and agentic system infrastructure.Sat, 10 Jan 2026 00:00:00 GMTTechaimlopsdataopsmachine-learningai-engineeringmcpragproductionhttps://danielkeller.com/flying/circling-approach/https://danielkeller.com/flying/circling-approach/A step-by-step technique for flying the circling approach with confidence - the 45° break, 30-second rule, half-track-width correction, and constant-angle final turn. With Cirrus SR22T examples.Sun, 15 Jun 2025 00:00:00 GMTFlyingifrinstrument-approachcirclingeasafaaprocedurescirrus-sr22ttechniquehttps://danielkeller.com/flying/cirrus-sr22t-europe/https://danielkeller.com/flying/cirrus-sr22t-europe/Adventures and learnings from flying a Cirrus SR22T based at Schönhagen airfield near Berlin.Sun, 01 Jun 2025 00:00:00 GMTFlyingcirrussr22teasaeuropehttps://danielkeller.com/longevity/omega3/https://danielkeller.com/longevity/omega3/New research confirms omega-3 fatty acids slow biological aging, reduce inflammation, and support cardiovascular and cognitive health.Sat, 15 Feb 2025 00:00:00 GMTLongevityomega-3dhaepalongevityanti-agingcardiovascularcognitive-healthhttps://danielkeller.com/longevity/vo2-max/https://danielkeller.com/longevity/vo2-max/Why VO2 max is the strongest predictor of lifespan, how testing works, score benchmarks by age, and how to improve your cardiovascular fitness.Fri, 01 Nov 2024 00:00:00 GMTLongevityvo2-maxcardiovascularendurancelongevityfitness-testinghiitzone-2https://danielkeller.com/longevity/rmr/https://danielkeller.com/longevity/rmr/Understanding your resting metabolic rate - how RMR testing works, why it matters for longevity, and how to use the data to optimize health.Tue, 15 Oct 2024 00:00:00 GMTLongevityrmrmetabolismmetabolic-healthcaloric-needstestinglongevityhttps://danielkeller.com/longevity/microbiome/https://danielkeller.com/longevity/microbiome/How gut biome testing reveals microbial diversity, pathogenic imbalances, and actionable steps for optimizing longevity through gut health.Tue, 01 Oct 2024 00:00:00 GMTLongevitymicrobiomegut-healthprobioticsprebioticstestinginflammationhttps://danielkeller.com/leadership/product-operating-model/https://danielkeller.com/leadership/product-operating-model/Breaking down the Product Operating Model from Cagan's Transformed - empowered teams, outcome-based governance, and the shift from feature factories to value delivery.Tue, 01 Oct 2024 00:00:00 GMTLeadershipproduct-managementmarty-caganempowered-teamsproduct-operating-modelleadershiphttps://danielkeller.com/longevity/dexa-scan/https://danielkeller.com/longevity/dexa-scan/My experience with a DEXA scan - the gold standard in body composition analysis for bone density, muscle mass, and visceral fat tracking.Sun, 15 Sep 2024 00:00:00 GMTLongevitydexa-scanbody-compositionbone-densityvisceral-fatmuscle-masslongevityhttps://danielkeller.com/flying/us-west-coast-cirrus-sr22t-g5/https://danielkeller.com/flying/us-west-coast-cirrus-sr22t-g5/A flight report from a West Coast tour in a nearly new Cirrus SR22T G5 - from San Carlos to Las Vegas, Sedona, San Diego, Santa Monica, and over the Golden Gate Bridge at 1,000 ft.Sun, 15 Sep 2024 00:00:00 GMTFlyingcirrussr22tg5usawest-coastifrflight-reportcalifornialas-vegassedonasan-diegosanta-monicagolden-gatehttps://danielkeller.com/longevity/biomarkers/https://danielkeller.com/longevity/biomarkers/The most important biomarkers for longevity - metabolic, hormonal, cardiovascular, and inflammatory markers with optimal ranges.Sun, 01 Sep 2024 00:00:00 GMTLongevitybiomarkersblood-testsmetabolic-healthcardiovascularinflammationhormoneshttps://danielkeller.com/leadership/insights-driven-product-strategy/https://danielkeller.com/leadership/insights-driven-product-strategy/How to build a product strategy fueled by data, customer behavior, market trends, and experimentation rather than assumptions.Sun, 01 Sep 2024 00:00:00 GMTLeadershipproduct-strategyinsightsdataexperimentationproduct-managementhttps://danielkeller.com/longevity/supplements/https://danielkeller.com/longevity/supplements/My complete supplement stack optimized for longevity, exercise recovery, and sleep - with timing, dosages, and scientific rationale.Thu, 15 Aug 2024 00:00:00 GMTLongevitysupplementslongevitynadomega-3magnesiumcreatinenootropicshttps://danielkeller.com/longevity/sauna-science/https://danielkeller.com/longevity/sauna-science/TOP10 science-backed evidence on health benefits of sauna - from cardiovascular health to longevity and cognitive function.Thu, 01 Aug 2024 00:00:00 GMTLongevitysaunaheat-stresscardiovascularlongevityrecoverysciencehttps://danielkeller.com/flying/cirrus-sr22tn-procedures/https://danielkeller.com/flying/cirrus-sr22tn-procedures/Complete operating procedures for the Cirrus SR22TN - speeds, takeoff, climb, LOP operations, traffic pattern, landing, IFR approaches, maneuvers, and emergencies.Thu, 01 Aug 2024 00:00:00 GMTFlyingcirrussr22tnproceduresifrtakeofflandinglopcapsemergencieshttps://danielkeller.com/leadership/priorities-and-focus/https://danielkeller.com/leadership/priorities-and-focus/Why organizations spread too thin and how a single prioritization framework, clear product vision, and the discipline to say no can transform delivery.Thu, 01 Aug 2024 00:00:00 GMTLeadershipprioritizationfocusleadershipstrategyproduct-managementhttps://danielkeller.com/longevity/red-meat/https://danielkeller.com/longevity/red-meat/The connection between eating red meat, Neu5Gc, and chronic inflammation - why I limit red meat to 1-2 times per month.Mon, 15 Jul 2024 00:00:00 GMTLongevityred-meatneu5gcinflammationcancerdietsciencehttps://danielkeller.com/longevity/red-light-therapy/https://danielkeller.com/longevity/red-light-therapy/TOP10 science-backed evidence on health benefits of red light therapy - from cellular energy to muscle recovery and brain health.Mon, 01 Jul 2024 00:00:00 GMTLongevityred-light-therapyphotobiomodulationrecoverymitochondriasciencehttps://danielkeller.com/flying/checklists/https://danielkeller.com/flying/checklists/Custom checklists for the Cirrus SR22TN - VFR/IFR main checklist, approach procedures for precision and non-precision approaches, and a complete IFR flight planning checklist.Mon, 01 Jul 2024 00:00:00 GMTFlyingcirrussr22tnchecklistsifrflight-planningapproachilsrnavhttps://danielkeller.com/leadership/product-vision-and-strategy/https://danielkeller.com/leadership/product-vision-and-strategy/How to craft a compelling product vision that is customer-centric, insight-driven, and leverages industry trends - with practical guidance on making it immersive.Mon, 01 Jul 2024 00:00:00 GMTLeadershipproduct-visionstrategyproduct-managementleadershipinsightshttps://danielkeller.com/longevity/nutrition-math/https://danielkeller.com/longevity/nutrition-math/The healthiest foods ranked by nutrient density, plus TOP10 lists for fiber, omega-3, probiotics, and superfoods.Sat, 15 Jun 2024 00:00:00 GMTLongevitynutritionnutrient-densityfiberomega-3probioticssuperfoodsrankingshttps://danielkeller.com/flying/aviation-formulas/https://danielkeller.com/flying/aviation-formulas/Complete formula collection for the Instrument Rating - navigation, radio aids, altimetry, pressure corrections, airspeed conversions, gyroscopic drift, and bearing diagrams.Sat, 15 Jun 2024 00:00:00 GMTFlyingformulasrules-of-thumbinstrument-flightnavigationreferenceinstrument-ratinghttps://danielkeller.com/longevity/nutrition-table/https://danielkeller.com/longevity/nutrition-table/Comprehensive nutrition reference table with fiber, carbohydrates, protein, and omega-3 content per 100g for common longevity foods.Sat, 01 Jun 2024 00:00:00 GMTLongevitynutritionfiberomega-3proteinreference-tablefood-datahttps://danielkeller.com/leadership/digitalization/https://danielkeller.com/leadership/digitalization/The 10 biggest mistakes in digital transformation and why companies that fail to put technology at their core will not survive.Sat, 01 Jun 2024 00:00:00 GMTLeadershipdigitalizationtransformationleadershipstrategyplatform-economyhttps://danielkeller.com/longevity/training-plan/https://danielkeller.com/longevity/training-plan/Heart rate zones, weekly training schedule, and detailed workout plans for HIIT, MICT, strength, and VO2 Max training.Wed, 15 May 2024 00:00:00 GMTLongevitytraining-planhiitmictstrengthvo2-maxheart-rate-zonesrowinghttps://danielkeller.com/leadership/book-zero-to-one/https://danielkeller.com/leadership/book-zero-to-one/Key learnings from the book and a personal meeting with Peter Thiel on focus, scalability, hiring 10xers, and building the future.Wed, 15 May 2024 00:00:00 GMTLeadershipbooksstartupspeter-thielinnovationstrategynetwork-effectshttps://danielkeller.com/longevity/chia-pudding/https://danielkeller.com/longevity/chia-pudding/Why chia pudding with goji berries is a fiber, omega-3, and nutrient powerhouse - recipe, preparation tips, and nutritional breakdown.Wed, 01 May 2024 00:00:00 GMTLongevitychia-seedsnutritionfiberomega-3breakfastrecipegut-healthhttps://danielkeller.com/leadership/software-delivery/https://danielkeller.com/leadership/software-delivery/A structured approach to diagnosing and fixing delivery bottlenecks in scaled organizations, based on the Delft University research framework.Wed, 01 May 2024 00:00:00 GMTLeadershipsoftware-deliveryagiledevopsroot-cause-analysisengineering-managementhttps://danielkeller.com/leadership/book-transformational-products/https://danielkeller.com/leadership/book-transformational-products/How established companies can survive through continuous innovation - user behavior shifts, technology waves, monetization strategies, and platform thinking.Mon, 15 Apr 2024 00:00:00 GMTLeadershipbooksproduct-developmentdigital-transformationplatformsmonetizationinnovationhttps://danielkeller.com/longevity/avoid/https://danielkeller.com/longevity/avoid/The habits to avoid for better health, movement, and sleep - bad food, sedentary lifestyle, and sleep disruptors.Mon, 01 Apr 2024 00:00:00 GMTLongevityalcoholprocessed-foodsedentarysleep-disruptorsblue-lightmovementhttps://danielkeller.com/longevity/boost/https://danielkeller.com/longevity/boost/Sauna therapy and red light therapy - how I use heat stress and photobiomodulation to boost metabolism, recovery, and overall health.Fri, 15 Mar 2024 00:00:00 GMTLongevitysaunared-light-therapymetabolismrecoveryheat-stressphotobiomodulationhttps://danielkeller.com/leadership/book-empowered/https://danielkeller.com/leadership/book-empowered/Comprehensive notes from the book and workshops with Marty Cagan on empowered product teams, strategic context, team topology, and product strategy.Fri, 15 Mar 2024 00:00:00 GMTLeadershipbooksproduct-managementmarty-caganempowered-teamsproduct-strategyokrshttps://danielkeller.com/longevity/mental/https://danielkeller.com/longevity/mental/Keys to longevity and a meaningful life - the gut-brain connection, lifelong learning, cognitive resilience, and the power of social bonds.Fri, 01 Mar 2024 00:00:00 GMTLongevitymental-healthsocial-connectionsfamilygut-brain-axisblue-zonescognitive-healthhttps://danielkeller.com/leadership/book-five-dysfunctions-of-a-team/https://danielkeller.com/leadership/book-five-dysfunctions-of-a-team/Key learnings on building cohesive teams through trust, constructive conflict, commitment, accountability, and collective results.Fri, 01 Mar 2024 00:00:00 GMTLeadershipbooksleadershipteamworktrustculturehttps://danielkeller.com/longevity/eat/https://danielkeller.com/longevity/eat/My protocol on what I eat daily to become a centenarian - fixing my digestive system, caloric restriction, gut health, and nutrient-dense meals.Thu, 15 Feb 2024 00:00:00 GMTLongevitynutritiongut-healthcaloric-restrictionfiberprobioticsomega-3supplementshttps://danielkeller.com/leadership/book-platform-revolution/https://danielkeller.com/leadership/book-platform-revolution/How platforms leverage network effects to scale faster than traditional pipeline businesses - key concepts, design principles, and why platforms disrupt industries.Thu, 15 Feb 2024 00:00:00 GMTLeadershipbooksplatformsnetwork-effectsmarketplacestrategybusiness-modelhttps://danielkeller.com/longevity/exercise/https://danielkeller.com/longevity/exercise/How I built a structured, sustainable exercise routine focused on rowing, swimming, strength training, and VO2 Max optimization.Thu, 01 Feb 2024 00:00:00 GMTLongevityexerciserowingswimmingstrengthvo2-maxconcept2longevityhttps://danielkeller.com/leadership/book-amp-it-up/https://danielkeller.com/leadership/book-amp-it-up/Comprehensive notes from one of the strongest leadership books - covering standards, culture, focus, pace, and strategy transformation.Thu, 01 Feb 2024 00:00:00 GMTLeadershipbooksleadershipexecutionculturestrategyhiringhttps://danielkeller.com/leadership/book-thinking-fast-and-slow/https://danielkeller.com/leadership/book-thinking-fast-and-slow/Must-read insights on System 1 vs System 2 thinking, cognitive biases, loss aversion, and how understanding your brain leads to better decisions.Sat, 20 Jan 2024 00:00:00 GMTLeadershipbookspsychologydecision-makingcognitive-biasneurosciencehttps://danielkeller.com/longevity/sleep/https://danielkeller.com/longevity/sleep/How I fixed my sleep and boosted energy levels and motivation by magnitudes. Tracking, routines, supplements, and a comprehensive sleep checklist.Mon, 15 Jan 2024 00:00:00 GMTLongevitysleeprecoverysupplementsapple-watchouramelatoninmagnesiumhttps://danielkeller.com/leadership/book-drive/https://danielkeller.com/leadership/book-drive/Daniel Pink's framework for intrinsic motivation: autonomy, mastery, and purpose - and why it's so often ignored in practice.Mon, 15 Jan 2024 00:00:00 GMTLeadershipbooksmotivationleadershipautonomymasterypurposehttps://danielkeller.com/leadership/book-rework/https://danielkeller.com/leadership/book-rework/Notes on simplicity, prioritization, execution speed, and building products that matter - lessons that influenced a decade of my thinking.Wed, 10 Jan 2024 00:00:00 GMTLeadershipbookssimplicityexecutionproduct-developmentstartupprioritizationhttps://danielkeller.com/longevity/intro/https://danielkeller.com/longevity/intro/A science-backed framework for thriving to 100 - six fundamental pillars covering sleep, exercise, nutrition, mental health, recovery, and what to avoid.Mon, 01 Jan 2024 00:00:00 GMTLongevitylongevityprotocolhealth-spanpeter-attiasix-pillarshttps://danielkeller.com/leadership/intro-product-and-tech/https://danielkeller.com/leadership/intro-product-and-tech/An overview of Daniel Keller's career across product and technology leadership - from BMW to four successful company exits with a combined exit value over $1.6B.Mon, 01 Jan 2024 00:00:00 GMTLeadershipleadershipcareerexitsctocpo